Kittanningis a borough in Armstrong County, Pennsylvania, United States, and its county seat. It is situated 36 miles northeast of Pittsburgh, along the east bank of the Allegheny River. The population was 3,921 at the 2020 census.NewspapersinKittanninginclude theLeaderTimes.

Understanding the Context

Clipping found in Simpson'sLeader-Timespublished inKittanning, Pennsylvania on 10/26/1957. Simpson'sLeader-Times1929-77 (NewspaperinKittanning, Pennsylvania) Ancestry.OfflineNewspapersforKittanning. According to the USNewspaperDirectory, the followingnewspaperswere printed, so there may bepaperor microfilm copies available. The Evolution of theKittanningLeaderTimes.

Key Insights

Thepaperdidn’t just appear out of thin air. It’s the product of a 1921 merger between theKittanningDailyLeaderand theKittanningDailyTimes. Back then,newspaperswere partisan. It’s a very excitingtimeinKittanning, for the firsttimein arguably a half century there are serious signs of growth, development and opportunity. As I speak with many residents, there is an upbeat attitude, and I believe there are plenty of reasons for this momentum.

Final Thoughts

WESTARMKittanningFacility Director Kelsey Cushey, DPT, will join Dr. Formaini in conducting the lecture. She recently won second place in theLeaderTimes’ Best of the Best in 2021. Verskeie berigte in The StraitsTimes, 1886-1890 te. Kittanninghistoricalnewspapersare an incredibly useful tool for discovering who you are and where you came from. OurKittanning, Pennsylvanianewspaperarchive enables you to explore differentnewspapersgoing back decades.

Websearch and browse 32 years ofkittanningleadertimesnewspapersfrom 1964 to 1995. Find news, obituaries, clippings, and more fromkittanning, pennsylvania. Week 6 high school football recap Thekittanningpaper.com Domain Statistics. Title:KittanningPaper.kittanningpapercompany,kittanningpaper,kittanningnewspaper,kittanningleadertimesweather, thekittanningpaper.